PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 59aa    MW: 6996.08 Da    PI: 10.5439
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06453.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69e-161357348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eE+e++++a +++++g Wk++a ++g ++t+ q   + qky+
        PK06453.1 13 MWTKEEHERFLEALEMYPSGPWKKVADHIG-TKTPRQTMTHAQKYR 57
                     5*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.187659IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-8856IPR009057Homeodomain-like
SuperFamilySSF466891.64E-14958IPR009057Homeodomain-like
SMARTSM007172.2E-81059IPR001005SANT/Myb domain
PfamPF002491.4E-131357IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.3E-111359IPR006447Myb domain, plants
CDDcd001671.71E-101456No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
GAVVMSSKHR IQMWTKEEHE RFLEALEMYP SGPWKKVADH IGTKTPRQTM THAQKYRQK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPITG_11731T01e-31(Phytophthora infestans)
STRINGPYU1_T0031087e-31(Pythium ultimum)
STRINGPITG_19362T01e-30(Phytophthora infestans)
STRINGPhyra733051e-30(Phytophthora ramorum)
STRINGPhyso1313123e-30(Phytophthora sojae)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10113.11e-12MYB_related family protein